CK1 delta (Middle Region) anticorps

N° du produit ABIN630662

L’anticorps Lapin Polyclonal anti- a été validé pour WB. Il convient pour détecter dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CK1 delta (Middle Region) anticorps (ABIN630662)

Antigène: CK1 delta

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: CK1 delta antibody was raised against the middle region of CSNK1 D

Purification: Affinity purified

Immunogène: CK1 delta antibody was raised using the middle region of CSNK1 D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK1 delta Blocking Peptide, (ABIN5612897), is also available for use as a blocking control in assays to test for specificity of this CK1 delta antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: CK1 delta

Sujet: This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair.

Poids moléculaire: 47 kDa (MW of target protein)